PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla010793
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family CO-like
Protein Properties Length: 356aa    MW: 40428.3 Da    PI: 5.0292
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla010793genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box32.12.3e-101962542
   zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
               +C+ +e+ ++++ C+ +   lC+ C  e+H+       H++vp+
  Cla010793 19 TCEACERAPAEFICKADAASLCAVCDAEIHSAnplarrHQRVPI 62
               8*****************************66899999**9997 PP

2CCT70.54.3e-24287330144
        CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                Rea++lRY+eK+ktRkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  Cla010793 287 REARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRT 330
                9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003362.3E-151562IPR000315B-box-type zinc finger
PROSITE profilePS5011910.8081562IPR000315B-box-type zinc finger
PfamPF006438.9E-81962IPR000315B-box-type zinc finger
CDDcd000211.82E-102062No hitNo description
PROSITE profilePS5101716.648287329IPR010402CCT domain
PfamPF062036.8E-18287329IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MLKIEDEYRG DANGWGSVTC EACERAPAEF ICKADAASLC AVCDAEIHSA NPLARRHQRV  60
PINGVAVFGR VEEEEEESNE EEEAASWLLM NPPKNNYNKN NNNHNNNELF LLGREDEEEE  120
DDEYLKFVEF NENNNNNGFG DHEDDIDEFE GLKNSNNNNY GGGGDSVVPI DQFEGNKNHH  180
HHHHHQQQQQ HHQQHQVLME QSYEGLIDAS EFFHSSSKSS YSYNAFLNHT ISVSSMEVGV  240
VPDSTTTTMS DISISNMRPP KGTIDLFSGT TAAAIQMPAT QLSPMDREAR VLRYREKKKT  300
RKFEKTIRYA SRKAYAETRP RIKGRFAKRT DVELQLDRKF SNPLIPEAGY GIVPSF
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818701e-109LN681870.1 Cucumis melo genomic scaffold, anchoredscaffold00035.
GenBankLN7132611e-109LN713261.1 Cucumis melo genomic chromosome, chr_7.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004137263.11e-176PREDICTED: zinc finger protein CONSTANS-LIKE 2-like
TrEMBLA0A0A0KY361e-176A0A0A0KY36_CUCSA; Uncharacterized protein
STRINGPOPTR_0004s10800.11e-97(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38273352
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02380.12e-30CONSTANS-like 2